Chronological index from 244301 to 244400

Sitename Alexa Rank    Sitename Alexa Rank
  randfwebdev.com  30,173,468   novosibexpress.ru  10,991,985
  onenessjewelry.com  1,208,716   vormat.de  6,357,222
  adfest.com  613,107   aciklise.net  1,324,362
  angeladigiovanni.com  4,823,129   topronpaulsites.com  24,580,246
  jiasu.cn  5,567,545   oneness.at  10,768,617
  cinetubegratis.net  19,331,973   jonah-kath.co.uk  1,767,514
  prettypushers.com  1,534,522   thephil.org  9,877,393
  bookpeople.com  417,528   kbboutiques.eu  11,331,822
  houseman.jp  0   bjornstaging.com  11,519,051
  pe-ta-nge.com  11,474,199   cashflowheavenpublishing.com  1,330,950
  outset.tv  0   myanmarstriker.com  166,782
  milandesign.sg  4,410,691   zenradio.fr  1,238,359
  mifarmaciaonline.es  756,021   kolgotki-chulki.ru  8,218,164
  jaor.net  10,756,482   togaherer.com  1,244,250
  flashist.ru  6,283,209   nforum.biz  1,521,492
  goldengate.vc  486,864   whoareyouwearingnow.com  8,203,700
  URL Hidden  1,223,494   youhavemetmeataverystrangetimeinmylife.wordpress.com  8,699,234
  zepter-moscow.ru  2,776,686   scriptcanyon.com  19,576,920
  usinsk.eu  634,363   URL Hidden  1,761,781
  loveland.nl  1,321,672   asperger.es  1,106,116
  URL Hidden  5,635,338   fidelidademaxima.com  0
  ec8s.com  1,915,314   aspergersinfo.wordpress.com  2,051,495
  domain-bot.org  20,995,512   targislubne.zgora.pl  0
  23developer.com  0   URL Hidden  2,207,529
  qq-bz.com  1,461,506   sayesayangiz.blogspot.com  4,704,063
  aero.com  978,265   wraxtiorre.blogspot.com  12,472,243
  yuxuange.com  10,092,818   yokoi-package.co.jp  1,315,472
  5.com  1,269,181   robot-electronics.co.uk  442,719
  trang-fc.com  6,763,325   96yx.com  1,999,171
  websolutionworld.com  6,822,982   ceq.com.cn  1,017,241
  medallioncabinetry.com  843,366   twitmais.com  922,780
  cmsplanet.ru  1,338,122   backpacker.gr  2,217,453
  johnboydbooks.com  0   kaisha-seturitu.com  3,351,306
  rusgsm.ru  7,743,201   abeukmembers.com  1,116,494
  bestchoicevietnam.com  24,138,918   litigationexecutive.com  0
  irpco.ir  5,228,500   thecogworks.co.uk  2,208,784
  protica.com  1,778,021   sangramsingh.weebly.com  0
  spread2.asia  14,008,170   canhsatmoitruong.gov.vn  6,067,320
  bb-magazine.com  2,513,964   bdallas.com  3,260,049
  quellecheiltombolo.blogspot.com  0   alarm-motors.ru  525,467
  sunniebunniezz.com  2,786,350   mementosecurity.com  7,694,036
  provision.ir  1,125,035   nkm-blog.org  10,867,717
  URL Hidden  1,330,445   0559fc.com  10,929,831
  abc-p.jp  9,554,558   youthwelfare.net  13,618,644
  vellapanti.co  0   secev.co.jp  0
  marcinignac.com  1,221,703   manganarutoonepiece.com  11,948,574
  eustak.com  10,493,832   footypd.com  4,113,123
  irockcleveland.com  4,744,985   gutschrome.com  0
Archive 244101-244400 244201-244300 244401-244500 244501-244600 244601-244700 244701-244800